PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G211200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 1030aa    MW: 114084 Da    PI: 7.8738
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G211200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.17e-40149226178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+e+C+adl++ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Manes.03G211200.1.p 149 VCQAEDCRADLTNAKDYHRRHKVCDIHSKASKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 226
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-31144211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.77147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-37148229IPR004333Transcription factor, SBP-box
PfamPF031109.7E-28150223IPR004333Transcription factor, SBP-box
SMARTSM00248230800829IPR002110Ankyrin repeat
SuperFamilySSF484032.35E-7801916IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-6803913IPR020683Ankyrin repeat-containing domain
CDDcd002042.08E-7805916No hitNo description
SMARTSM0024819857887IPR002110Ankyrin repeat
SMARTSM002482800897926IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1030 aa     Download sequence    Send to blast
MEAKIRGKSH HFHGPVVSDL KAVGKKSLEW DLNDWKWDGD LFAATPLNSV PSDYRSRQLF  60
PVGPEIPATG GLFTGSASCS DNNDLGLEKE KRELEKRRRV VVAQDEDFTD DAAGSLNLKL  120
GGQAYPILDE DAKSGKKTKF IGTASNRAVC QAEDCRADLT NAKDYHRRHK VCDIHSKASK  180
ALVGNVMQRF CQQCSRFHVL QEFDEGKRSC RRRLAGHNKR RRKTHPENVV SGGSLNDENG  240
SGYLLISLLR ILSNLPTNSS NQTKDQDLLS HLLRNLANIA GTTSGRSISG LLQESQGLIN  300
AGTTVGTLEK VPNMIRNGFE SAGPSTSASK KDDCTNSHDA VRPLGQFGTP PVSDLAQKRI  360
FNNDFQGGIP EAISGPQSTE LFPSRCNLPT KVNESAAVVG RIKFNNIDLN SAYDGSQDCS  420
GNIERSIAPV NPVTGSASCP LWEQSDFHKK NPQMSGNSDS TSQSPSSSNG EAQSRTDRIV  480
FKLFGKEPND FPVALRTQIL DWLSHSPTDI ESYIRPGCII LTLYLRLSRS QWEEICLNLG  540
TSLSILLNAS IDSFWRTGWV YARVQHCVSF IYNGQVVLDT PLHLKSHKSC RILSVKPVAV  600
SLSERMHFLV KGFNISRPTT RLLCALEGKY LVQENSCYLM DGADGNNDCH ELQCLSFPCS  660
IPNITGRGFI EVEDHGLSSS FFPFIVAEQE VCREIRVLEE AIEVVEAADD IHKNAEGIEA  720
KNQALDFIHE MGWLLHRSHL KFRLGHLYRN SDLFPFGRCK WLIEFSINHD WCAVVKKLLV  780
ILFEGTVDTG DHSSIELALL DMNLLHQAVR RNCRPMVELL LKFVPDKPFG RQGAEQKQGV  840
NGKNNNFIFK PDVVGPAGLT PLHVAASKDG SENVLDALTD DPGLVGIEAW RTARDSTGLT  900
PNDYACLRGY YSYMHLVQRK IKKSENGHVV LNIPKSLPDC STQRKDGLKS SKITGLEIGK  960
MEMQQHCKLC EMKLACGQTR TSLVYRPAML SMVTIAAVCV CVALLFKSSP EVLYVFQPFR  1020
WELLKYGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-301492231084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19599KRRRV
2218224KRRRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519316.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
TrEMBLB9RZZ70.0B9RZZ7_RICCO; Squamosa promoter-binding protein, putative
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1